SwiftScapes Co
Back to BlogGuides

Pool Deck Materials: What Works Best Around Austin Pools

Michael R.2024-11-158 min read
Pool Deck Materials: What Works Best Around Austin Pools

Your pool deck needs to handle Austin's intense summer heat while staying safe and beautiful. The wrong material choice can mean burned feet, slippery surfaces, or constant maintenance headaches. Here's what actually works around Austin pools.

The Heat Factor: Why It Matters Most

On a 100°F Austin summer day, surface temperatures can reach: - Dark concrete: 140-150°F - Standard pavers: 120-135°F - Travertine: 95-110°F - Cool deck coating: 100-115°F

The threshold for foot discomfort is around 120°F. Choose your materials accordingly.

Best Pool Deck Materials for Austin

1. Travertine (Our Top Pick) **Why it excels:** Natural stone that stays remarkably cool even in direct sun.

  • Cost: $15-30 per sq ft installed
  • Heat rating: Excellent (stays 20-30°F cooler than concrete)
  • Slip resistance: Good when tumbled/honed finish
  • Maintenance: Seal every 2-3 years
  • Lifespan: 50+ years

Best for: Homeowners who prioritize comfort and luxury aesthetics.

2. Concrete Pavers with Cool Technology **Why it excels:** Modern pavers with reflective pigments stay cooler than traditional options.

  • Cost: $12-25 per sq ft installed
  • Heat rating: Good (15-20°F cooler than standard pavers)
  • Slip resistance: Excellent with textured finish
  • Maintenance: Minimal—occasional cleaning
  • Lifespan: 25-40 years

Best for: Those wanting design flexibility with improved comfort.

3. Stamped Concrete with Cool Deck Coating **Why it excels:** Affordable base with heat-reducing coating.

  • Cost: $10-18 per sq ft installed
  • Heat rating: Good with proper coating
  • Slip resistance: Excellent when textured
  • Maintenance: Reseal coating every 3-5 years
  • Lifespan: 20-30 years

Best for: Budget-conscious homeowners who still want comfort.

4. Natural Flagstone **Why it excels:** Timeless Hill Country aesthetic with good heat properties.

  • Cost: $18-35 per sq ft installed
  • Heat rating: Good (lighter colors stay cooler)
  • Slip resistance: Varies by stone type
  • Maintenance: Seal periodically, watch for loose stones
  • Lifespan: 40+ years

Best for: Those wanting a natural, organic look.

Materials to Avoid Around Austin Pools

Dark-Colored Anything Dark pavers, stained concrete, or dark stone will be unbearably hot. If you love dark colors, use them only in shaded areas.

Smooth Concrete Slippery when wet and extremely hot. If using concrete, always add texture and consider a cool deck coating.

Wood Decking While beautiful, wood around pools in Austin means: - Splinters from sun damage - Constant sealing requirements - Warping and checking - Potential for mold/mildew

Rubber/Composite Decking Often marketed as "cool," but many products still get quite hot and can have a cheap appearance.

Safety Features to Include

Slip Resistance - Choose textured finishes - Avoid polished or smooth surfaces - Consider grip additives in sealers

Proper Drainage - 1-2% slope away from pool - Channel drains at house/fence lines - No puddle-prone low spots

Edge Treatments - Bullnose coping for comfortable sitting - Contrasting color at pool edge for visibility - Rounded edges to prevent injuries

Design Ideas for Austin Pool Decks

The Resort Look - Large format travertine pavers - Integrated spa with matching deck - Built-in chaise lounge areas - Fire feature for evening ambiance

Hill Country Natural - Irregular flagstone with planted joints - Native grass borders - Boulder accents - Natural stone coping

Modern Minimalist - Gray concrete pavers in linear pattern - Clean geometric lines - Integrated planters - LED strip lighting

Family-Friendly - Textured cool deck surface - Generous deck space for activities - Shaded areas with pergola - Easy-clean materials

Cost Comparison for 800 sq ft Pool Deck

MaterialMaterial CostInstallationTotal
Stamped Concrete$4,000-6,000$4,000-6,000$8,000-12,000
Concrete Pavers$6,000-10,000$6,000-10,000$12,000-20,000
Travertine$8,000-14,000$8,000-12,000$16,000-26,000
Flagstone$10,000-16,000$8,000-14,000$18,000-30,000

Maintenance Tips for Pool Decks

Weekly - Skim debris from surface - Rinse with hose to remove chlorine residue

Monthly - Check for loose pavers or stones - Clean any algae growth in shaded areas - Inspect caulking at pool edge

Annually - Professional cleaning/pressure washing - Reseal if needed - Check drainage function

Ready to Create Your Perfect Pool Deck?

The right pool deck transforms your backyard into a true outdoor oasis. Schedule a free design consultation and let's create a pool deck that's beautiful, comfortable, and built to last.

pool decktravertinepaverssafetyheat

Ready to Start Your Project?

Get a free consultation and see how we can transform your outdoor space.